Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT10 Peptide - C-terminal region

CNOT10 Peptide - C-terminal region

Product Specifications

UniProt

F8WAF2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNOT10 Rabbit Polyclonal Antibody (orb326956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243671

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AVPI1-set siRNA/shRNA/RNAi Lentivector (Human)
12881091 4x 500 ng

AVPI1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Anti-EVA1A Antibody
TA351821 100 µL

Rabbit Polyclonal Anti-EVA1A Antibody

Sign In for Pricing
View Details
Enterokinase (ENTK), Recombinant, Bovine, His-Tag
051835-01 10 µg

Enterokinase (ENTK), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Enterokinase (ENTK), Recombinant, Bovine, His-Tag
051835-02 50 µg

Enterokinase (ENTK), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Enterokinase (ENTK), Recombinant, Bovine, His-Tag
051835-03 100 µg

Enterokinase (ENTK), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details
Enterokinase (ENTK), Recombinant, Bovine, His-Tag
051835-04 200 µg

Enterokinase (ENTK), Recombinant, Bovine, His-Tag

Sign In for Pricing
View Details