Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPSF4L Peptide - N-terminal region

CPSF4L Peptide - N-terminal region

Product Specifications

UniProt

A6NMK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPSF4L Rabbit Polyclonal Antibody (orb587341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123357

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC W006-Tri 100-AL-CRD/1 AC Signs
827214 Card of 1 Pictogram(s)

PIC W006-Tri 100-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
MAT2A Recombinant Antibody
bsm-62405R-TR 20 µL

MAT2A Recombinant Antibody

Sign In for Pricing
View Details
Rabbit anti-Bcl10 Antibody, Affinity Purified
MBS3903843-01 0.01 mg

Rabbit anti-Bcl10 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Bcl10 Antibody, Affinity Purified
MBS3903843-02 0.1 mg

Rabbit anti-Bcl10 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Bcl10 Antibody, Affinity Purified
MBS3903843-03 5x 0.01 mg

Rabbit anti-Bcl10 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-Bcl10 Antibody, Affinity Purified
MBS3903843-04 5x 0.1 mg

Rabbit anti-Bcl10 Antibody, Affinity Purified

Sign In for Pricing
View Details