Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPSF4L Peptide - N-terminal region

CPSF4L Peptide - N-terminal region

Product Specifications

UniProt

A6NMK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPSF4L Rabbit Polyclonal Antibody (orb587341) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123357

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpxcr1 (NM_001033471) Mouse Tagged Lenti ORF Clone
MR218885L4 10 µg

Cpxcr1 (NM_001033471) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BAI2 Adenovirus (Mouse)
12995055 1.0 mL

BAI2 Adenovirus (Mouse)

Sign In for Pricing
View Details
LONRF3 (NM_001031855) Human Over-expression Lysate
LS079836-100ug 100 µg

LONRF3 (NM_001031855) Human Over-expression Lysate

Sign In for Pricing
View Details
PLEKHA9 Rabbit Polyclonal Antibody (FITC)
orb2102766 100 µL

PLEKHA9 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
AURKB antibody
MBS830780-01 0.1 mL

AURKB antibody

Sign In for Pricing
View Details
AURKB antibody
MBS830780-02 5x 0.1 mL

AURKB antibody

Sign In for Pricing
View Details