Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBF4B Peptide - N-terminal region

DBF4B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASKL1, CHIFB, DRF1, ZDBF1B

UniProt

Q8NFT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBF4B Rabbit Polyclonal Antibody (orb587353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAP Recombinant Antibody, Cy5.5 Conjugated
bsm-60636R-Cy5.5 100 µL

FAP Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Rab32 ORF Vector (Rat) (pORF)
38322016 1.0 µg DNA

Rab32 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Lamtor1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7593407 1.0 µg DNA

Lamtor1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human DUSP14 Protein, N-His
orb2962802-01 50 µg

Recombinant Human DUSP14 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DUSP14 Protein, N-His
orb2962802-02 100 µg

Recombinant Human DUSP14 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DUSP14 Protein, N-His
orb2962802-03 1 mg

Recombinant Human DUSP14 Protein, N-His

Sign In for Pricing
View Details