Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF4L2 Peptide - N-terminal region

DCAF4L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR21C

UniProt

Q8NA75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF4L2 Rabbit Polyclonal Antibody (orb326960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689631

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MESKRPRLLEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin IIa (phospho-Ser1943) Rabbit Polyclonal Antibody
E28PP1409 100 µL

Myosin IIa (phospho-Ser1943) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beta-Amyloid (32-35)
VAC-00503-01 5 mg

Beta-Amyloid (32-35)

Sign In for Pricing
View Details
Beta-Amyloid (32-35)
VAC-00503-02 10 mg

Beta-Amyloid (32-35)

Sign In for Pricing
View Details
Beta-Amyloid (32-35)
VAC-00503-03 25 mg

Beta-Amyloid (32-35)

Sign In for Pricing
View Details
IGLCOR22-1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1061802 1.0 µg DNA

IGLCOR22-1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TAG-72 (CA 72.4, Tumor associated glycoprotein 72) (BSA & Azide Free) (MaxLight 550)
MBS6220133-01 0.1 mL

TAG-72 (CA 72.4, Tumor associated glycoprotein 72) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details