Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF4L2 Peptide - N-terminal region

DCAF4L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR21C

UniProt

Q8NA75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF4L2 Rabbit Polyclonal Antibody (orb326960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689631

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MESKRPRLLEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SFTPC Matched Antibody Pair Set [Poly/RD1147]
Z01LS-1122-LS121 5 Plates

Human SFTPC Matched Antibody Pair Set [Poly/RD1147]

Sign In for Pricing
View Details
Stat 5b, CT (Signal Transducer And Activator Of Transcription 5B) (MaxLight 650)
MBS6501031-01 0.1 mL

Stat 5b, CT (Signal Transducer And Activator Of Transcription 5B) (MaxLight 650)

Sign In for Pricing
View Details
Stat 5b, CT (Signal Transducer And Activator Of Transcription 5B) (MaxLight 650)
MBS6501031-02 5x 0.1 mL

Stat 5b, CT (Signal Transducer And Activator Of Transcription 5B) (MaxLight 650)

Sign In for Pricing
View Details
TRAC, Recombinant, Human, aa1-142, His-Tag (T-cell Receptor Alpha Chain C Region)
375660-01 20 µg

TRAC, Recombinant, Human, aa1-142, His-Tag (T-cell Receptor Alpha Chain C Region)

Sign In for Pricing
View Details
TRAC, Recombinant, Human, aa1-142, His-Tag (T-cell Receptor Alpha Chain C Region)
375660-02 100 µg

TRAC, Recombinant, Human, aa1-142, His-Tag (T-cell Receptor Alpha Chain C Region)

Sign In for Pricing
View Details
TRAC, Recombinant, Human, aa1-142, His-Tag (T-cell Receptor Alpha Chain C Region)
375660-03 1 mg

TRAC, Recombinant, Human, aa1-142, His-Tag (T-cell Receptor Alpha Chain C Region)

Sign In for Pricing
View Details