Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF17 Peptide - N-terminal region

DCAF17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C2orf37

UniProt

F5H7W1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF17 Rabbit Polyclonal Antibody (orb326965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158293

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1 Antibody (ATTO 565)
abx449761 100 µg

FOXO1 Antibody (ATTO 565)

Sign In for Pricing
View Details
Myo9b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6800106 1.0 µg DNA

Myo9b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
FITC Anti-Mouse CD86 Antibody
MBS4514849-01 0.025 mg

FITC Anti-Mouse CD86 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD86 Antibody
MBS4514849-02 0.05 mg

FITC Anti-Mouse CD86 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD86 Antibody
MBS4514849-03 0.2 mg

FITC Anti-Mouse CD86 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD86 Antibody
MBS4514849-04 0.1 mg

FITC Anti-Mouse CD86 Antibody

Sign In for Pricing
View Details