Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF17 Peptide - N-terminal region

DCAF17 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C2orf37

UniProt

F5H7W1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF17 Rabbit Polyclonal Antibody (orb326965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158293

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKB Protein Vector (Human) (pPM-C-His)
PV009580 500 ng

CKB Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CDYL (CDYL1, Chromodomain Protein) (AP)
MBS6445579-01 0.1 mL

CDYL (CDYL1, Chromodomain Protein) (AP)

Sign In for Pricing
View Details
CDYL (CDYL1, Chromodomain Protein) (AP)
MBS6445579-02 5x 0.1 mL

CDYL (CDYL1, Chromodomain Protein) (AP)

Sign In for Pricing
View Details
ARF3 Rabbit Polyclonal Antibody (Center D93)
E28PB2408 100 µL

ARF3 Rabbit Polyclonal Antibody (Center D93)

Sign In for Pricing
View Details
Antigen TB15.3 (M. Tuberculosis/CDC1551)
IT-500-019Ep-01 0.1 mg

Antigen TB15.3 (M. Tuberculosis/CDC1551)

Sign In for Pricing
View Details
Antigen TB15.3 (M. Tuberculosis/CDC1551)
IT-500-019Ep-02 1 mg

Antigen TB15.3 (M. Tuberculosis/CDC1551)

Sign In for Pricing
View Details