DCDC2B Peptide - N-terminal region
DCDC2B Peptide - N-terminal region
Product Specifications
UniProt
A2VCK2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DCDC2B Rabbit Polyclonal Antibody (orb587355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001092904
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6276839-01 0.1 mL
ATXN7L2, CT (ATXN7L2, Ataxin-7-like protein 2) (MaxLight 550)
Sign In for Pricing
View Details MBS6276839-02 5x 0.1 mL
ATXN7L2, CT (ATXN7L2, Ataxin-7-like protein 2) (MaxLight 550)
Sign In for Pricing
View Details MBS2089881-01 5x 96 Tests
Mouse Procollagen III N-Terminal Propeptide (PIIINP) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2089881-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Mouse Procollagen III N-Terminal Propeptide (PIIINP) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2089881-03 10x 96 Tests
Mouse Procollagen III N-Terminal Propeptide (PIIINP) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2089881-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Mouse Procollagen III N-Terminal Propeptide (PIIINP) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details