DCDC2B Peptide - N-terminal region
DCDC2B Peptide - N-terminal region
Product Specifications
UniProt
A2VCK2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DCDC2B Rabbit Polyclonal Antibody (orb587355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001092904
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1712-500 1x 500 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1712), 0.2mg/mL
Sign In for Pricing
View Details 
RDR-AEBP1-Hu-01 96 Tests
Human AE Binding Protein 1 (AEBP1) ELISA Kit
Sign In for Pricing
View Details RDR-AEBP1-Hu-02 48 Tests
Human AE Binding Protein 1 (AEBP1) ELISA Kit
Sign In for Pricing
View Details 
