DHRS7C Peptide - C-terminal region
DHRS7C Peptide - C-terminal region
Product Specifications
Product Name Alternative
SDR32C2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DHRS7C Rabbit Polyclonal Antibody (orb587358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099041
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471190-500 1x 500 µL
Cytokeratin 18 (KRT18/1190), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GAF-441-20 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific, 20nm
Sign In for Pricing
View Details ![Frataxin (FXN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F3]](https://cdn.genprice.uk/products/937/68dd1b6d061270361ea17284/imageurl/ta504341am.webp)
TA504341AM 100 µL
Frataxin (FXN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F3]
Sign In for Pricing
View Details 
HA725200 100 µL
Human MCP4/CCL13 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details