Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS12 Peptide - C-terminal region

DHRS12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDR40C1

UniProt

A0PJE2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHRS12 Rabbit Polyclonal Antibody (orb587360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001257353

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps13 (BC011192) Mouse Tagged ORF Clone
MG200883 10 µg

Rps13 (BC011192) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Serological Pipettes
P8270-05 200 Units/Case

Serological Pipettes

Sign In for Pricing
View Details
6-Desacetyl-6-ethoxyvinyl-N-Boc Palbociclib-d4
TRC-D199082-25MG 25 mg

6-Desacetyl-6-ethoxyvinyl-N-Boc Palbociclib-d4

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF647 conjugate, 0.1mg/mL
BNC473019-500 1x 500 µL

CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(S)-Chlorpheniramine Maleate Salt
TRC-C424305-500MG 500 mg

(S)-Chlorpheniramine Maleate Salt

Sign In for Pricing
View Details
Polystyrene AM COOH
H12516003.25G 25 g

Polystyrene AM COOH

Sign In for Pricing
View Details