Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS12 Peptide - C-terminal region

DHRS12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDR40C1

UniProt

A0PJE2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHRS12 Rabbit Polyclonal Antibody (orb587360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001257353

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWAQGHPAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63 Recombinant Rabbit monoclonal Antibody
HA750218 100 µL

P63 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HINT2 (NM_032593) Human Recombinant Protein
TP308371L 1 mg

HINT2 (NM_032593) Human Recombinant Protein

Sign In for Pricing
View Details
CELF-1 Antibody
8C11440-AAT 50 µg

CELF-1 Antibody

Sign In for Pricing
View Details
Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: OTI8F4]
CF804209 100 µg

Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: OTI8F4]

Sign In for Pricing
View Details
BAIAP2 (NM_017451) Human Recombinant Protein
TP317285L 1 mg

BAIAP2 (NM_017451) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS505634 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details