Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS13 Peptide - C-terminal region

DHRS13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDR7C5

UniProt

Q6UX07

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHRS13 Rabbit Polyclonal Antibody (orb587361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653284

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPO Antibody
57-470 400 µL

CPO Antibody

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)
MBS1151553-01 0.02 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)
MBS1151553-02 0.02 mg (Yeast)

Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)
MBS1151553-03 0.1 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)
MBS1151553-04 0.1 mg (Yeast)

Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)
MBS1151553-05 0.02 mg (Baculovirus)

Recombinant Lysinibacillus sphaericus Lactate utilization protein B (lutB)

Sign In for Pricing
View Details