Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRS13 Peptide - C-terminal region

DHRS13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SDR7C5

UniProt

Q6UX07

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHRS13 Rabbit Polyclonal Antibody (orb587361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653284

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acsl1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6899602 1.0 µg DNA

Acsl1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
GM2/GD2 Synthase (C-5) HRP
sc-376505 HRP 200 µg/mL

GM2/GD2 Synthase (C-5) HRP

Sign In for Pricing
View Details
Vom1r59 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6282904 1.0 µg DNA

Vom1r59 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CD62p Polyclonal Antibody, Cy5 Conjugated
bs-0561R-Cy5 100 µL

CD62p Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
DEFB112 Antibody
orb255800 100 µL

DEFB112 Antibody

Sign In for Pricing
View Details
Myotubularin-Related protein 11 (MTMR11) Human ELISA Kit
F2104 96 Tests

Myotubularin-Related protein 11 (MTMR11) Human ELISA Kit

Sign In for Pricing
View Details