Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAH3 Peptide - N-terminal region

SIAH3 Peptide - N-terminal region

Product Specifications

UniProt

Q8IW03

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIAH3 Rabbit Polyclonal Antibody (orb587277) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hemoglobin Gamma 2 (HBg2) Human ELISA Kit
D9778 96 Tests

Hemoglobin Gamma 2 (HBg2) Human ELISA Kit

Sign In for Pricing
View Details
Human Syntaxin-BP2 Affinity Purified Polyclonal Ab
AF5900-SP 25 µg

Human Syntaxin-BP2 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Rabbit Monoclonal Phosphoglucomutase 5 Antibody (PGM5/7005R) [DyLight 405]
NBP3-14134V 0.1 mL

Rabbit Monoclonal Phosphoglucomutase 5 Antibody (PGM5/7005R) [DyLight 405]

Sign In for Pricing
View Details
JCHAIN Recombinant Protein (Human)
OPCA05246-20UG 20 µg

JCHAIN Recombinant Protein (Human)

Sign In for Pricing
View Details
Human Coagulation Factor XI (FXI) ELISA Kit
JL42275-01 48 Tests

Human Coagulation Factor XI (FXI) ELISA Kit

Sign In for Pricing
View Details
Human Coagulation Factor XI (FXI) ELISA Kit
JL42275-02 96 Tests

Human Coagulation Factor XI (FXI) ELISA Kit

Sign In for Pricing
View Details