Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAH3 Peptide - N-terminal region

SIAH3 Peptide - N-terminal region

Product Specifications

UniProt

Q8IW03

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SIAH3 Rabbit Polyclonal Antibody (orb587277) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phosphodiesterase 10A (PDE10A) ELISA Kit
BSKH64036-01 48 Tests

Human Phosphodiesterase 10A (PDE10A) ELISA Kit

Sign In for Pricing
View Details
Human Phosphodiesterase 10A (PDE10A) ELISA Kit
BSKH64036-02 96 Tests

Human Phosphodiesterase 10A (PDE10A) ELISA Kit

Sign In for Pricing
View Details
Olfr1031 (NM_001011759) Mouse Tagged ORF Clone Lentiviral Particle
MR215534L3V 200 µL

Olfr1031 (NM_001011759) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CIRBP, CT (CIRBP, A18HNRNP, CIRP, Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP) (Biotin)
MBS6286197-01 0.2 mL

CIRBP, CT (CIRBP, A18HNRNP, CIRP, Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP) (Biotin)

Sign In for Pricing
View Details
CIRBP, CT (CIRBP, A18HNRNP, CIRP, Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP) (Biotin)
MBS6286197-02 5x 0.2 mL

CIRBP, CT (CIRBP, A18HNRNP, CIRP, Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal CD45RB Antibody (BRA-11 (same as BRA-11G)) [Janelia Fluor 646]
NBP2-34564JF646 0.1 mL

Mouse Monoclonal CD45RB Antibody (BRA-11 (same as BRA-11G)) [Janelia Fluor 646]

Sign In for Pricing
View Details