Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD2B Peptide - C-terminal region

MFSD2B Peptide - C-terminal region

Product Specifications

UniProt

A6NFX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD2B Rabbit Polyclonal Antibody (orb587300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073942

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDASSRLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP6K1 Rabbit pAb, PerCP-Cy7 conjugated
orb2875338 100 µL

IP6K1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Nautilia profundicola Protein RecA (recA)
MBS1137490-01 0.02 mg (E-Coli)

Recombinant Nautilia profundicola Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Nautilia profundicola Protein RecA (recA)
MBS1137490-02 0.02 mg (Yeast)

Recombinant Nautilia profundicola Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Nautilia profundicola Protein RecA (recA)
MBS1137490-03 0.1 mg (E-Coli)

Recombinant Nautilia profundicola Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Nautilia profundicola Protein RecA (recA)
MBS1137490-04 0.1 mg (Yeast)

Recombinant Nautilia profundicola Protein RecA (recA)

Sign In for Pricing
View Details
Recombinant Nautilia profundicola Protein RecA (recA)
MBS1137490-05 0.02 mg (Baculovirus)

Recombinant Nautilia profundicola Protein RecA (recA)

Sign In for Pricing
View Details