Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD2B Peptide - C-terminal region

MFSD2B Peptide - C-terminal region

Product Specifications

UniProt

A6NFX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD2B Rabbit Polyclonal Antibody (orb587300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073942

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDASSRLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EMAP-II/AIMP1 Antibody [Biotin]
NBP2-98343B 0.1 mL

Rabbit Polyclonal EMAP-II/AIMP1 Antibody [Biotin]

Sign In for Pricing
View Details
RGD1306119 3'UTR GFP Stable Cell Line
TU267623 1.0 mL

RGD1306119 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
turboGFP, AlpSdAbs® VHH (Biotin)
HA710189 100 µg

turboGFP, AlpSdAbs® VHH (Biotin)

Sign In for Pricing
View Details
Mouse Usp38 Pre-designed siRNA Set A
SI115781A 1 Each

Mouse Usp38 Pre-designed siRNA Set A

Sign In for Pricing
View Details
APP Knockout A549 Polyclonal Cells
ARG38716 1 Million

APP Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Oasl1 Mouse shRNA Plasmid (Locus ID 231655)
TL506948 1 Kit

Oasl1 Mouse shRNA Plasmid (Locus ID 231655)

Sign In for Pricing
View Details