ANKRD18B Peptide - C-terminal region
ANKRD18B Peptide - C-terminal region
Product Specifications
Product Name Alternative
BA255A11.3, bA255A11.5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANKRD18B Rabbit Polyclonal Antibody (orb587318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001716377
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVNIPDIIHIHKEALTKVMESRQHVAEGKTEVQRLMMSESQEQDFFGHCG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
