ANKRD18B Peptide - C-terminal region
ANKRD18B Peptide - C-terminal region
Product Specifications
Product Name Alternative
BA255A11.3, bA255A11.5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANKRD18B Rabbit Polyclonal Antibody (orb587318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001716377
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVNIPDIIHIHKEALTKVMESRQHVAEGKTEVQRLMMSESQEQDFFGHCG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942990-500 1x 500 µL
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-R124003-1MG 1 mg
Rapamycin-13C,d3 (contains d0) Technical Grade
Sign In for Pricing
View Details 
