SLC35G4 Peptide - N-terminal region
SLC35G4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AMAC1L1
UniProt
P0C7Q5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC35G4 Rabbit Polyclonal Antibody (orb326948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_934053
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CYP21A2 Mouse Monoclonal Antibody [Clone ID: OTI7B6]](https://cdn.genprice.uk/products/937/68dd18bc061270361e90916f/imageurl/cf814804.webp)
CF814804 100 µg
CYP21A2 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
Sign In for Pricing
View Details ![HRP Conjugated CCR7 Recombinant Rabbit Monoclonal Antibody [SR36-04]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81c58/imageurl/ha721185.webp)
HA721185 100 µL
HRP Conjugated CCR7 Recombinant Rabbit Monoclonal Antibody [SR36-04]
Sign In for Pricing
View Details 
![PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B3]](https://cdn.genprice.uk/products/937/68dd1b7b061270361ea1c233/imageurl/ta804471am.webp)
TA804471AM 100 µL
PAFAH1B3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B3]
Sign In for Pricing
View Details 
