SLC35G4 Peptide - N-terminal region
SLC35G4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AMAC1L1
UniProt
P0C7Q5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC35G4 Rabbit Polyclonal Antibody (orb326948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_934053
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942885-100 1x 100 µL
CD81 / TAPA-1 (C81/2885R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![IRF3 Mouse Monoclonal Antibody [Clone ID: OTI2G6]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90857d/imageurl/cf809334.webp)
![PISD Mouse Monoclonal Antibody [Clone ID: OTI2C1]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90806e/imageurl/cf807337.webp)
PKSH032000-01 10 µg
Recombinant Human Osteopontin/SPP1 Protein (His Tag)
Sign In for Pricing
View Details