Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS56 Peptide - C-terminal region

PRSS56 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MCOP6

UniProt

P0CW18

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS56 Rabbit Polyclonal Antibody (orb587328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182058

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRAAGTRFPKRRPEPRGEANGCPGLEPLRQKLAALQGAHAWILQVPSEHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human calnexin, CNX ELISA Kit
YLA0091HU-01 48 Tests

Human calnexin, CNX ELISA Kit

Sign In for Pricing
View Details
Human calnexin, CNX ELISA Kit
YLA0091HU-02 96 Tests

Human calnexin, CNX ELISA Kit

Sign In for Pricing
View Details
Lentiviral human WWC3 shRNA (UAS) - Lentiviral human WWC3 shRNA (UAS, GFP) (100)
GTR15311388 1 Vial

Lentiviral human WWC3 shRNA (UAS) - Lentiviral human WWC3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CD127/IL7R Rabbit pAb
E45R18948N 50 ul

CD127/IL7R Rabbit pAb

Sign In for Pricing
View Details
PLM (Phospho-S68) Mouse Monoclonal Antibody
orb1473612-01 30 µL

PLM (Phospho-S68) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PLM (Phospho-S68) Mouse Monoclonal Antibody
orb1473612-02 50 μL

PLM (Phospho-S68) Mouse Monoclonal Antibody

Sign In for Pricing
View Details