PRSS56 Peptide - C-terminal region
PRSS56 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MCOP6
UniProt
P0CW18
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRSS56 Rabbit Polyclonal Antibody (orb587328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001182058
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRAAGTRFPKRRPEPRGEANGCPGLEPLRQKLAALQGAHAWILQVPSEHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![2,2,2-Trifluoro-1-[4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -3,6-dihydro-2H-pyridin-1-yl]ethanone](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
PC1002044-01 50 mg
2,2,2-Trifluoro-1-[4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -3,6-dihydro-2H-pyridin-1-yl]ethanone
Sign In for Pricing
View Details PC1002044-02 100 mg
2,2,2-Trifluoro-1-[4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -3,6-dihydro-2H-pyridin-1-yl]ethanone
Sign In for Pricing
View Details PC1002044-03 250 mg
2,2,2-Trifluoro-1-[4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -3,6-dihydro-2H-pyridin-1-yl]ethanone
Sign In for Pricing
View Details PC1002044-04 1 g
2,2,2-Trifluoro-1-[4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -3,6-dihydro-2H-pyridin-1-yl]ethanone
Sign In for Pricing
View Details PC1002044-05 5 g
2,2,2-Trifluoro-1-[4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -3,6-dihydro-2H-pyridin-1-yl]ethanone
Sign In for Pricing
View Details