Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM43B Peptide - N-terminal region

TRIM43B Peptide - N-terminal region

Product Specifications

UniProt

A6NCK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM43B Rabbit Polyclonal Antibody (orb587331) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157936

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CREPSPKMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRQTKKMFC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGRN Polyclonal Antibody
E-AB-15907-01 20 µL

AGRN Polyclonal Antibody

Sign In for Pricing
View Details
AGRN Polyclonal Antibody
E-AB-15907-02 60 µL

AGRN Polyclonal Antibody

Sign In for Pricing
View Details
AGRN Polyclonal Antibody
E-AB-15907-03 120 µL

AGRN Polyclonal Antibody

Sign In for Pricing
View Details
AGRN Polyclonal Antibody
E-AB-15907-04 200 µL

AGRN Polyclonal Antibody

Sign In for Pricing
View Details
Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody
AP06466PU-N 100 µg

Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bromocresol Green
TRC-B683333-5G 5 g

Bromocresol Green

Sign In for Pricing
View Details