Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN-DT Peptide - middle region

AFDN-DT Peptide - middle region

Product Specifications

Product Name Alternative

HGC6.4, AFDN-AS1, C6orf124, MLLT4-AS1, dJ431P23.3

UniProt

Q9Y6Z5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AFDN-DT Rabbit Polyclonal Antibody (orb326952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035973

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVLGSVRTGGAGSKWAALGPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC728485 activation kit by CRISPRa
GA118947 1 Kit

Human LOC728485 activation kit by CRISPRa

Sign In for Pricing
View Details
CXCL14 (NM_004887) Human Over-expression Lysate
LC401525 20 µg

CXCL14 (NM_004887) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Bromo-3-fluoroaniline
TRC-B684550-25G 25 g

4-Bromo-3-fluoroaniline

Sign In for Pricing
View Details
Beta Glucuronidase Antibody
KC-3954-01 50 μL

Beta Glucuronidase Antibody

Sign In for Pricing
View Details
Beta Glucuronidase Antibody
KC-3954-02 100 µL

Beta Glucuronidase Antibody

Sign In for Pricing
View Details
Beta Glucuronidase Antibody
KC-3954-03 1 mL

Beta Glucuronidase Antibody

Sign In for Pricing
View Details