AFDN-DT Peptide - middle region
AFDN-DT Peptide - middle region
Product Specifications
Product Name Alternative
HGC6.4, AFDN-AS1, C6orf124, MLLT4-AS1, dJ431P23.3
UniProt
Q9Y6Z5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AFDN-DT Rabbit Polyclonal Antibody (orb326952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035973
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVLGSVRTGGAGSKWAALGPM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA397637S 100 µg
Goat IgG (H&L) Antibody ATTO 550 Conjugated Pre-Adsorbed
Sign In for Pricing
View Details 
