DSCC1 Peptide - middle region
DSCC1 Peptide - middle region
Product Specifications
Product Name Alternative
DCC1
UniProt
Q9BVC3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DSCC1 Rabbit Polyclonal Antibody (orb587365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076999
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6008617-01 0.05 mg
QRSL1 (Glutaminyl-tRNA Synthase-like Protein 1, Glutamyl-tRNA(Gln) Amidotransferase Subunit A, Mitochondrial, Glu-AdT Subunit A, GatA)
Sign In for Pricing
View Details MBS6008617-02 5x 0.05 mg
QRSL1 (Glutaminyl-tRNA Synthase-like Protein 1, Glutamyl-tRNA(Gln) Amidotransferase Subunit A, Mitochondrial, Glu-AdT Subunit A, GatA)
Sign In for Pricing
View Details 