Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSCC1 Peptide - middle region

DSCC1 Peptide - middle region

Product Specifications

Product Name Alternative

DCC1

UniProt

Q9BVC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DSCC1 Rabbit Polyclonal Antibody (orb587365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076999

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Density Lipoprotein Receptor Class A Domain Containing 2 (LDLRAD2) Antibody
abx331019 100 µL

Low Density Lipoprotein Receptor Class A Domain Containing 2 (LDLRAD2) Antibody

Sign In for Pricing
View Details
CYB5R4
CSB-CL006321HU 10 μg Plasmid + 200 μL Glycerol

CYB5R4

Sign In for Pricing
View Details
FBXW11 Antibody
CSB-PA008521GA01HU 100 µL

FBXW11 Antibody

Sign In for Pricing
View Details
SLC19A1
ARP44167_T100 100 µL

SLC19A1

Sign In for Pricing
View Details
OGG1 Recombinant Antibody, Cy3 Conjugated
bsm-61557R-Cy3-01 20 µL

OGG1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
OGG1 Recombinant Antibody, Cy3 Conjugated
bsm-61557R-Cy3-02 100 µL

OGG1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details