Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYTN Peptide - C-terminal region

DYTN Peptide - C-terminal region

Product Specifications

UniProt

A2CJ06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYTN Rabbit Polyclonal Antibody (orb587370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001087199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAAVEKKEAGNIKERKDELEEEELQELLSKLMDAFNLETPSGPESSVNMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB538899 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
RC3H2 (NM_001100588) Human Over-expression Lysate
LC420271 20 µg

RC3H2 (NM_001100588) Human Over-expression Lysate

Sign In for Pricing
View Details
RMND5A Antibody
KC-2734-01 50 μL

RMND5A Antibody

Sign In for Pricing
View Details
RMND5A Antibody
KC-2734-02 100 µL

RMND5A Antibody

Sign In for Pricing
View Details
RMND5A Antibody
KC-2734-03 1 mL

RMND5A Antibody

Sign In for Pricing
View Details
RPS6KA1 Antibody
F40249-0.4ML 0.4 mL

RPS6KA1 Antibody

Sign In for Pricing
View Details