Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYTN Peptide - C-terminal region

DYTN Peptide - C-terminal region

Product Specifications

UniProt

A2CJ06

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYTN Rabbit Polyclonal Antibody (orb587370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001087199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAAVEKKEAGNIKERKDELEEEELQELLSKLMDAFNLETPSGPESSVNMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-m-tolyl Phosphate-d14(>85%)
TRC-D436802-1MG 1 mg

Di-m-tolyl Phosphate-d14(>85%)

Sign In for Pricing
View Details
Human ZNF93 activation kit by CRISPRa
GA113157 1 Kit

Human ZNF93 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Collagen Type XII (COL12) ELISA Kit
RDR-COL12-Ra-01 96 Tests

Rat Collagen Type XII (COL12) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type XII (COL12) ELISA Kit
RDR-COL12-Ra-02 48 Tests

Rat Collagen Type XII (COL12) ELISA Kit

Sign In for Pricing
View Details
Manual Pipette Controller BPIP-402
BPIP-402 1 Unit

Manual Pipette Controller BPIP-402

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS644364 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details