Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFR3B Peptide - C-terminal region

EFR3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0953

UniProt

Q9Y2G0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFR3B Rabbit Polyclonal Antibody (orb587374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055786

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQLTDEDRLSKRRSIGETISLQVEVESRNSPEKEERVPAEEITYETLKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syt12 Mouse qPCR Primer Pair (NM_134164)
MP216494 200 Reactions

Syt12 Mouse qPCR Primer Pair (NM_134164)

Sign In for Pricing
View Details
Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag
054665-01 10 µg

Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag
054665-02 50 µg

Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag
054665-03 100 µg

Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag
054665-04 200 µg

Mucin 7, Secreted (MUC7), Recombinant, Human, His-Tag, GST-Tag

Sign In for Pricing
View Details
TSG101 Rabbit Polyclonal Antibody (Fluoro550)
orb3074388 100 µg

TSG101 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details