Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENPP7 Peptide - N-terminal region

ENPP7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALK-SMase

UniProt

Q6UWV6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ENPP7 Rabbit Polyclonal Antibody (orb587380) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848638

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EID3 (NM_001008394) Human Tagged ORF Clone Lentiviral Particle
RC205575L3V 200 µL

EID3 (NM_001008394) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 2 (TNFR2, CD120b) discontinued
T9161-21C 100 µL

Tumor Necrosis Factor Receptor 2 (TNFR2, CD120b) discontinued

Sign In for Pricing
View Details
Asunaprevir
C10555-5mg 5 mg

Asunaprevir

Sign In for Pricing
View Details
TJP2 Polyclonal Antibody, Biotin Conjugated
bs-4844R-Biotin 100 µL

TJP2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human MS4A15 shRNA Plasmid
abx966445-01 150 µg

Human MS4A15 shRNA Plasmid

Sign In for Pricing
View Details
Human MS4A15 shRNA Plasmid
abx966445-02 300 µg

Human MS4A15 shRNA Plasmid

Sign In for Pricing
View Details