FAM24B Peptide - N-terminal region
FAM24B Peptide - N-terminal region
Product Specifications
UniProt
Q8N5W8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM24B Rabbit Polyclonal Antibody (orb587384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689857
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVLCLYFKIHNALKAAKEPEAVAVKNHNPDKVWWAKNSQAKTIATESCPA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680204-500 1x 500 µL
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740994-100 1x 100 µL
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400029-500 1x 500 µL
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details