Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALHM5 Peptide - middle region

CALHM5 Peptide - middle region

Product Specifications

Product Name Alternative

FAM26E, C6orf188, dJ493F7.3

UniProt

Q8N5C1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALHM5 Rabbit Polyclonal Antibody (orb587386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_714922

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinol Binding Protein (RBP) discontinued
R1701-16C 100 µg

Retinol Binding Protein (RBP) discontinued

Sign In for Pricing
View Details
MBNL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV712197 1.0 µg DNA

MBNL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rapid HiColiform® Broth w/Tryptophan
M1453A-500G 500 g

Rapid HiColiform® Broth w/Tryptophan

Sign In for Pricing
View Details
Ebola Virus (MaxLight 750) discontinued
214803-ML750 100 µL

Ebola Virus (MaxLight 750) discontinued

Sign In for Pricing
View Details
RPE65 Human shRNA Plasmid Kit (Locus ID 6121)
TL309764 1 Kit

RPE65 Human shRNA Plasmid Kit (Locus ID 6121)

Sign In for Pricing
View Details
Gamma enolase antibody
MBS5300275-01 0.1 mg

Gamma enolase antibody

Sign In for Pricing
View Details