CALHM5 Peptide - middle region
CALHM5 Peptide - middle region
Product Specifications
Product Name Alternative
FAM26E, C6orf188, dJ493F7.3
UniProt
Q8N5C1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CALHM5 Rabbit Polyclonal Antibody (orb587386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_714922
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2044719-01 0.1 mL
PE-Linked Polyclonal Antibody to Fibrillin 1 (FBN1)
Sign In for Pricing
View Details 
MBS2044719-02 0.2 mL
PE-Linked Polyclonal Antibody to Fibrillin 1 (FBN1)
Sign In for Pricing
View Details 
MBS2044719-03 0.5 mL
PE-Linked Polyclonal Antibody to Fibrillin 1 (FBN1)
Sign In for Pricing
View Details MBS2044719-04 1 mL
PE-Linked Polyclonal Antibody to Fibrillin 1 (FBN1)
Sign In for Pricing
View Details MBS2044719-05 5 mL
PE-Linked Polyclonal Antibody to Fibrillin 1 (FBN1)
Sign In for Pricing
View Details MBS2044719-06 5x 5 mL
PE-Linked Polyclonal Antibody to Fibrillin 1 (FBN1)
Sign In for Pricing
View Details