Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM45A Peptide - C-terminal region

FAM45A Peptide - C-terminal region

Product Specifications

UniProt

Q8TCE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM45A Rabbit Polyclonal Antibody (orb55732) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996892

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQLIVQSAEDPEKSESHVIQDIALKTREIFTNLAPFSEVSADGEKRVLNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/1030), CF640R conjugate, 0.1mg/mL
BNC401030-100 1x 100 µL

CD66 (CEA) (C66/1030), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
BNC680334-500 1x 500 µL

Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF568 conjugate, 0.1mg/mL
BNC681628-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details