RIPOR1 Peptide - N-terminal region
RIPOR1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FAM65A
UniProt
Q6ZS17
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RIPOR1 Rabbit Polyclonal Antibody (orb326975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078795
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SCETKDLFAALPQVVAVDINDLGTIKLSLEVTWSPFDKDDQPSAASSVNK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040994-100 1x 100 µL
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941081-100 1x 100 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941098-100 1x 100 µL
Cyclin B1 (CCNB1/1098), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471783-500 1x 500 µL
CD45RB (B-Cell Marker) (PTPRC/1783R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details