EEF2KMT Peptide - C-terminal region
EEF2KMT Peptide - C-terminal region
Product Specifications
Product Name Alternative
EFM3, SB153, FAM86A, eEF2-KMT
UniProt
D3DUE9
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EEF2KMT Rabbit Polyclonal Antibody (orb587394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_963892
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2046806-01 0.1 mL
FITC-Linked Polyclonal Antibody to Membrane Protein, Palmitoylated 5 (MPP5)
Sign In for Pricing
View Details MBS2046806-02 0.2 mL
FITC-Linked Polyclonal Antibody to Membrane Protein, Palmitoylated 5 (MPP5)
Sign In for Pricing
View Details 
MBS2046806-03 0.5 mL
FITC-Linked Polyclonal Antibody to Membrane Protein, Palmitoylated 5 (MPP5)
Sign In for Pricing
View Details 
MBS2046806-04 1 mL
FITC-Linked Polyclonal Antibody to Membrane Protein, Palmitoylated 5 (MPP5)
Sign In for Pricing
View Details MBS2046806-05 5 mL
FITC-Linked Polyclonal Antibody to Membrane Protein, Palmitoylated 5 (MPP5)
Sign In for Pricing
View Details MBS2046806-06 5x 5 mL
FITC-Linked Polyclonal Antibody to Membrane Protein, Palmitoylated 5 (MPP5)
Sign In for Pricing
View Details