Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCED1B Peptide - C-terminal region

PCED1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM113B

UniProt

Q96HM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCED1B Rabbit Polyclonal Antibody (orb326978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLSQLLLAHVADAWGVELPHRHPVGEWIKKKKPGPRVEGPPQANRNHPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-jun Monoclonal Antibody, APC-Cy5.5 Conjugated
bsm-42049M-APC-Cy5.5 100 µL

C-jun Monoclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (PE)
248031-PE 100 µL

KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (PE)

Sign In for Pricing
View Details
Glass Beads (10-30µm)
07668-1 1 g

Glass Beads (10-30µm)

Sign In for Pricing
View Details
Zfp365 CRISPRa sgRNA lentivector (set of three targets)(Rat)
50937126 3x 1.0µg DNA

Zfp365 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
GNE-617
T4335-01 1 mg

GNE-617

Sign In for Pricing
View Details
GNE-617
T4335-02 2 mg

GNE-617

Sign In for Pricing
View Details