SAXO2 Peptide - middle region
SAXO2 Peptide - middle region
Product Specifications
Product Name Alternative
FAM154B
UniProt
Q658L1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SAXO2 Rabbit Polyclonal Antibody (orb587405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001008227
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KLH0047 96 Well
Hamster Soluble Intercellular Adhesion Molecule-1, sICAM-1 GENLISA ELISA
Sign In for Pricing
View Details 
VAng-Lsx9012-1mgEcoli 1 mg (E. coli)
Recombinant Clostridium Cellulolyticum rplQ Protein (aa 1-174)
Sign In for Pricing
View Details orb3022483-01 200 mg
2-Chloro-1- (10H-phenothiazin-10-yl) propan-1-one
Sign In for Pricing
View Details orb3022483-02 5 mg
2-Chloro-1- (10H-phenothiazin-10-yl) propan-1-one
Sign In for Pricing
View Details orb3022483-03 25 mg
2-Chloro-1- (10H-phenothiazin-10-yl) propan-1-one
Sign In for Pricing
View Details