FAM183BP Peptide - C-terminal region
FAM183BP Peptide - C-terminal region
Product Specifications
Product Name Alternative
THEG6, FAM183B
UniProt
Q6ZVS7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM183BP Rabbit Polyclonal Antibody (orb326992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001098752
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTENQEIGWDSEALVDPERRDHRMNHFRVYSDITLYKAKMWSLGEDDRHK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882167-100 1x 100 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details