Casp3 Peptide - middle region
Casp3 Peptide - middle region
Product Specifications
Product Name Alternative
A830040C14Rik, AC-3, Apopain, CC3, CPP32, Caspase-3, Lice, Yama, mldy
UniProt
P70677
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Casp3 Rabbit Polyclonal Antibody (orb584865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033940
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTA
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9360167-01 48 Well
Hamster Solute Carrier Family 22 Member 4 (SLC22A4) ELISA Kit
Sign In for Pricing
View Details 
MBS9360167-02 96 Well
Hamster Solute Carrier Family 22 Member 4 (SLC22A4) ELISA Kit
Sign In for Pricing
View Details MBS9360167-03 5x 96 Well
Hamster Solute Carrier Family 22 Member 4 (SLC22A4) ELISA Kit
Sign In for Pricing
View Details 
MBS9360167-04 10x 96 Well
Hamster Solute Carrier Family 22 Member 4 (SLC22A4) ELISA Kit
Sign In for Pricing
View Details