Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4b Peptide - C-terminal region

Eif4b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2310046H11Rik, AL024095, C85189, Eif4a2

UniProt

Q922K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4b Rabbit Polyclonal Antibody (orb331129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH07171

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp160 shRNA (UAS) - Lentiviral mouse Zfp160 shRNA (UAS, RFP) (25)
GTR15237059 1 Vial

Lentiviral mouse Zfp160 shRNA (UAS) - Lentiviral mouse Zfp160 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
WASF2 Antibody
ABD4618 100 µg

WASF2 Antibody

Sign In for Pricing
View Details
RPS19 Rabbit Monoclonal Antibody
AMRe84134-01 1 Each

RPS19 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RPS19 Rabbit Monoclonal Antibody
AMRe84134-02 50 µL

RPS19 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RPS19 Rabbit Monoclonal Antibody
AMRe84134-03 100 µL

RPS19 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDC2 Kinase/CDK1 Protein (N-His-GST, Mouse)
P514241 100 µg

CDC2 Kinase/CDK1 Protein (N-His-GST, Mouse)

Sign In for Pricing
View Details