Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4b Peptide - C-terminal region

Eif4b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2310046H11Rik, AL024095, C85189, Eif4a2

UniProt

Q922K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eif4b Rabbit Polyclonal Antibody (orb331129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH07171

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH3B2 Human Over-expression Lysate
orb1362199 20 µg

ALDH3B2 Human Over-expression Lysate

Sign In for Pricing
View Details
Mbp Mouse qPCR Primer Pair (NM_010777)
MP221112 200 Reactions

Mbp Mouse qPCR Primer Pair (NM_010777)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-1971-Off Virus
mm5298 1.0 mL

AdmiRa-mmu-miR-1971-Off Virus

Sign In for Pricing
View Details
BBC3 Antibody
orb1249035 0.1 mg

BBC3 Antibody

Sign In for Pricing
View Details
OR6A2 Rabbit Polyclonal Antibody (Cy7)
orb1071433 100 µL

OR6A2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
RPL21P74 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41080061 1.0 µg DNA

RPL21P74 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details