Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pstpip2 Peptide - N-terminal region

Pstpip2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAYP, cmo

UniProt

Q99M15

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pstpip2 Rabbit Polyclonal Antibody (orb585210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038859

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLSRKKPCGQSEINT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI (NM_001032281) Human Over-expression Lysate
LY422293 100 µg

TFPI (NM_001032281) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant BAT3 Antibody
RC-16276-01 50 μL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details
Recombinant BAT3 Antibody
RC-16276-02 100 µL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details
Recombinant BAT3 Antibody
RC-16276-03 1 mL

Recombinant BAT3 Antibody

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF594 conjugate, 0.1mg/mL
BNC941380-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
10mL Centrifuge Tubes
C2410 1000 Units/Case

10mL Centrifuge Tubes

Sign In for Pricing
View Details