Pstpip2 Peptide - N-terminal region
Pstpip2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAYP, cmo
UniProt
Q99M15
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pstpip2 Rabbit Polyclonal Antibody (orb585210) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038859
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLSRKKPCGQSEINT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040029-100 1x 100 µL
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040040-100 1x 100 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details