Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lman2 Peptide - N-terminal region

Lman2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Vip36

UniProt

B0BNG3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lman2 Rabbit Polyclonal Antibody (orb326409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001108496

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP2A-B56-δ (H5D12) Alexa Fluor® 488
sc-81605 AF488 200 µg/mL

PP2A-B56-δ (H5D12) Alexa Fluor® 488

Sign In for Pricing
View Details
Recombinant Macaca fascicularis albumin (ALB)
RPC24481-01 20 µg

Recombinant Macaca fascicularis albumin (ALB)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis albumin (ALB)
RPC24481-02 100 µg

Recombinant Macaca fascicularis albumin (ALB)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis albumin (ALB)
RPC24481-03 1 mg

Recombinant Macaca fascicularis albumin (ALB)

Sign In for Pricing
View Details
C6orf64 siRNA (h)
sc-95462 10 µM

C6orf64 siRNA (h)

Sign In for Pricing
View Details
Goat Amanitin (ANT) ELISA Kit
MBS9351091 Inquire

Goat Amanitin (ANT) ELISA Kit

Sign In for Pricing
View Details