Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lman2 Peptide - N-terminal region

Lman2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Vip36

UniProt

B0BNG3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lman2 Rabbit Polyclonal Antibody (orb326409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001108496

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (NM_001780) Human Recombinant Protein
E45H41255M5 20 µg

CD63 (NM_001780) Human Recombinant Protein

Sign In for Pricing
View Details
IFluor® 430 Anti-human CD87 Antibody *VIM5*
10870031-AAT 500 Tests

IFluor® 430 Anti-human CD87 Antibody *VIM5*

Sign In for Pricing
View Details
Dhdds ORF Vector (Rat) (pORF)
18169016 1.0 µg DNA

Dhdds ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Rat ARHGEF37 Protein, His (Fc)-Avi-tagged
ARHGEF37-428R 50 µg

Recombinant Rat ARHGEF37 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
UBE2D2 polyclonal antibody
orb645134-01 50 μL

UBE2D2 polyclonal antibody

Sign In for Pricing
View Details
UBE2D2 polyclonal antibody
orb645134-02 100 µL

UBE2D2 polyclonal antibody

Sign In for Pricing
View Details